General Information

  • ID:  hor004534
  • Uniprot ID:  P61278
  • Protein name:  Somatostatin-28
  • Gene name:  SST
  • Organism:  Homo sapiens (Human)
  • Family:  Somatostatin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with SST include Somatostatinoma and Acromegaly.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006972 hyperosmotic response; GO:0007166 cell surface receptor signaling pathway; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0007268 chemical synaptic transmission; GO:0007584 response to nutrient; GO:0007586 digestion; GO:0008285 negative regulation of cell population proliferation; GO:0008628 hormone-mediated apoptotic signaling pathway; GO:0009410 response to xenobiotic stimulus; GO:0010243 response to organonitrogen compound; GO:0010447 response to acidic pH; GO:0030334 regulation of cell migration; GO:0038170 somatostatin signaling pathway; GO:0043200 response to amino acid; GO:0048545 response to steroid hormone; GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043025 neuronal cell body; GO:0098982 GABA-ergic synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  SANSNPAMAPRERKAGCKNFFWKTFTSC
  • Length:  28
  • Propeptide:  MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  • Signal peptide:  MLSCRLQCALAALSIVLALGCVTG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Somatostatin-14]: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  SSTR5, SSTR2
  • Target Unid:  P35346, P30874
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 2.8±0.3 minute; /168 seconds ( PubMed ID: 6127205 )

Structure

  • Disulfide bond:  17-28
  • Structure ID:  AF-P61278-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004534_AF2.pdbhor004534_ESM.pdb

Physical Information

Mass: 363235 Formula: C137H209N41O39S3
Absent amino acids: DHILQVY Common amino acids: A
pI: 10.51 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -73.21 Boman Index: -6420
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 14.29
Instability Index: 3444.64 Extinction Coefficient cystines: 5625
Absorbance 280nm: 208.33

Literature

  • PubMed ID:  6127205
  • Title:  NA